PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_13046_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 211aa    MW: 24087.5 Da    PI: 10.1105
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_13046_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.83.3e-203784148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                          +g+WTteEd++lvd+++++G g+W++ ++  g++R++k+c++rw +yl
  cra_locus_13046_iso_2_len_1008_ver_3 37 KGPWTTEEDQKLVDYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 84
                                          79********************************************97 PP

2Myb_DNA-binding53.94e-1790135148
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                           rg++++eE++ +++++  lG++ W++Ia  ++ gRt++++k++w+++l
  cra_locus_13046_iso_2_len_1008_ver_3  90 RGKFSQEEEQTILHLHSILGNK-WSAIATNLP-GRTDNEIKNFWNTHL 135
                                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-262887IPR009057Homeodomain-like
PROSITE profilePS5129418.2073284IPR017930Myb domain
SuperFamilySSF466895.29E-3234131IPR009057Homeodomain-like
SMARTSM007171.7E-153686IPR001005SANT/Myb domain
PfamPF002493.0E-183784IPR001005SANT/Myb domain
CDDcd001677.33E-123984No hitNo description
PROSITE profilePS5129426.7285139IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2788140IPR009057Homeodomain-like
SMARTSM007173.4E-1689137IPR001005SANT/Myb domain
PfamPF002495.2E-1690135IPR001005SANT/Myb domain
CDDcd001671.51E-1192135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
XAGGVANRSK LKLLPKKETL VAEMGRSPCC DENGLKKGPW TTEEDQKLVD YIQKHGHGSW  60
RALPKLAGLN RCGKSCRLRW TNYLRPDIKR GKFSQEEEQT ILHLHSILGN KWSAIATNLP  120
GRTDNEIKNF WNTHLKKKLI QMGYDPMTHR PRTDLFSSLP NLIALATLLD QHQHFEELNA  180
VRLQAEAIQL AKLQYLQSLL QSNTTLFISF S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31351395108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009790391.11e-116PREDICTED: myb-related protein 315-like
SwissprotQ8GWP01e-73MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A068TYQ91e-117A0A068TYQ9_COFCA; Uncharacterized protein
STRINGSolyc04g074170.1.11e-111(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154